PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.011G039000.7
Common NameB456_011G039000, LOC105777006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 350aa    MW: 40175.7 Da    PI: 7.898
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.011G039000.7genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.32.7e-3180133255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Gorai.011G039000.7  80 PRLRWTPDLHYSFVRAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 133
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-2976134IPR009057Homeodomain-like
PROSITE profilePS5129411.71476136IPR017930Myb domain
SuperFamilySSF466891.56E-1479134IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-2280135IPR006447Myb domain, plants
PfamPF002492.6E-881132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MIEMHDEEQG EDVCAMPSRS RKCSSFDLND EAGSERDCIG ETSVEEEEIE NITEGSSSNN  60
NNGNGNDRRR VRQYVRSKLP RLRWTPDLHY SFVRAVERLG GQERATPKLV LQLMNVRGLS  120
IAHVKSHLQM YRSKKLDEAG QVLSQSKRAI QGRGEFGSLL CQAITTLSPH HGHQQQHFRM  180
ENGGIVLASE SLDGSNTTFK ANFPRHHQFP NSFISKAFGQ ENGFYIQNQI HGTGPIRAMA  240
SRFLEEKRWH PFERISNRWK VNGNMYKDMQ SQSHCFWQRP SSDEDKHEPL TKFSSCRTEF  300
EWNQDKVLKD GERLPDLQLR LSQRNGKFDE EKNNHCKGTH EISTQLSLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6323601e-168AY632360.1 Gossypium hirsutum BAC 106I22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012455487.10.0PREDICTED: two-component response regulator ARR14-like
RefseqXP_012455488.10.0PREDICTED: two-component response regulator ARR14-like
RefseqXP_012455490.10.0PREDICTED: two-component response regulator ARR14-like
TrEMBLA0A0D2T1Z40.0A0A0D2T1Z4_G
STRINGGLYMA08G12320.23e-74(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-37G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]